SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T001675 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T001675
Domain Number 1 Region: 54-114
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000157
Family HLH, helix-loop-helix DNA-binding domain 0.0042
Further Details:      
 
Weak hits

Sequence:  PYU1_T001675
Domain Number - Region: 282-326
Classification Level Classification E-value
Superfamily F-box domain 0.000294
Family F-box domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T001675
Sequence length 511
Comment protein Name="PYU1_T001675" Note="Similar to TFAP4: Transcription factor AP-4 (Homo sapiens)" AED:0.0408262647325086 QI:0|0.5|0.2|1|0.75|0.4|5|117|511
Sequence
MLTDSSYLGLESTDGNASTEDSDQHTAGVSNSGAIASRLLQLENNYERKKKRAKINRKDL
NARFQELMEILNLKEDRKLNRAKILEKTIEYIEKLEDELHAAKSQLDPKKATTVSPPNQP
APSPQMLLHNPSPSHAIGSGGPLMTFDPTNPHAWSATGHPAMPMTPMMWLPCSMMAPSGA
TLRNQRTRAEKRSTVRGGKPKQVAPGPSSTFMQTSVPASVTVEGARRNLKRSRESSTAEA
STPVNSTTAVVSTTVIQASKSEAASERLQSVFAWSAQEIPAVLAFCDAWMLARLMQTSKE
LGGAARQNKLWIELSRRRWGICGAQLQLSNALEQWKRWDREIYMPACGSTISGSIRFASG
RVKDIHIWGLLARRSNGRTTRTVLQSGKATVMQVVEIYLVVQNMSQARVHLTDQISVSPI
GNASAAASSSAFEPFPSGSNLCVLDIFLQCPGLDLEQEFLQRAAWLSVECKSELSQRTGA
AEAVTVRAQCLDEAQKKQLISTSYSSLDVEP
Download sequence
Identical sequences K3W9N4
PYU1_T001675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]