SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T001695 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T001695
Domain Number 1 Region: 3-51
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000815
Family Recombinase DNA-binding domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T001695
Sequence length 92
Comment protein Name="PYU1_T001695" Note="Similar to tc3a: Transposable element Tc3 transposase (Caenorhabditis elegans)" AED:0.04 QI:0|-1|0|1|-1|1|1|0|92
Sequence
MPKSIPLTELERGLVMAYHNEKLTIRNITERINRSSTVVYNFLQDPDKYGTAKRSGRPPA
LKKKDKRQLKKHASTGDFTATQLKKVLDLQVS
Download sequence
Identical sequences K3W9Q4
PYU1_T001695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]