SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T001698 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T001698
Domain Number 1 Region: 51-144
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000318
Family Single strand DNA-binding domain, SSB 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T001698
Sequence length 235
Comment protein Name="PYU1_T001698" Note="Protein of unknown function" AED:0.0321761851437103 QI:0|0.33|0.25|0.75|0.66|0.5|4|0|235
Sequence
SGTWISIIVESYVKLFAHQIAQQLVEFDGIPGSHAWKWRRDGIWHARLIIKAQVIGVLVS
VQERTERVEFLVDDGTALVKAVLWSASSWQKTVALGDLVHVEGKLNIDKNWHNDASTPMR
EIRVVRLSKVDDPNEELLHWAHVMELSKEVYSASAATSTTCSSGQRVEGVSTLSASHRHH
RHQEADTWDQIMVHAFFDLNVDADAKSRFLSREPRAAHDELLLTTLDDWLHEQRQ
Download sequence
Identical sequences K3W9Q7
PYU1_T001698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]