SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T001761 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T001761
Domain Number 1 Region: 109-294
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 3.02e-16
Family mRNA capping enzyme 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T001761
Sequence length 420
Comment protein Name="PYU1_T001761" Note="Similar to SNUPN: Snurportin-1 (Bos taurus)" AED:0.157037269252565 QI:0|0.66|0.42|0.85|1|1|7|0|420
Sequence
MMQKRTAVKNQQWMKDSVARRQAVLLQQRQARRDLALHARQLLTDDSSSGNEDGKSNRRN
RRHRGSDASAAVDDGMEVSSTYANGGGDTQSKRKTREERVKQRREHFAKQLMVPEWMIDI
PRDLNGKGSETGAGWYVLPRPEGKRCLVIANNGITVARIPSGSILKRFPSALPSGSHKTN
ASTESYCILDCIFHEHDSTFYVLDVMCWKGYLLYNCTTEFRLYWLRDKLSESTISTVSPA
NPYRFMPIPCYESDEHGICEAYSGTFPFLKDGLLFYMKVAHYELGLSPLVLVWKDANTSR
YFVYTEKPNIVLRLDGANQFTTLEGITFFTADSDFVKQHELSEGDLAKFSFDHGYIDDDN
KPCVAGLQFDKRCSPQRALADSWTKILFQYNARSGGVQIQHILEVAKTKAESNAEAVMED
Download sequence
Identical sequences K3W9X0
PYU1_T001761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]