SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T001773 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T001773
Domain Number - Region: 98-161
Classification Level Classification E-value
Superfamily Globin-like 0.0755
Family Globins 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T001773
Sequence length 422
Comment protein Name="PYU1_T001773" Note="Protein of unknown function" AED:0.474264277715566 QI:0|0|0|1|1|1|2|0|422
Sequence
MELEQELVAALRALELNEVPEDMVTSLFNTGGTAVLTADEAAEGADALFPDFVESVTVGQ
LRSVDCALTKYLRKHLAASAETDQMPRPNERLSSDYALLMVPEVAQLWEFFASEDAITAV
VGNENERAHSIAVYRTFFTLLQGTINIRDVYSKLDEEDKRRALVKALLASKVYLTWLQIP
GGSAYGIFMPYVYRQVLDVLKKWVALVRADAIAANSGATASRRVSVRQRTLKQKQKAAKR
KGKQQESEEDISELQQKMNKFGLDLFEMMATFLGNFSLASSTESIIPTIEMVIHLQNTVL
DDDVGSAVTGKSLKVVSSLLNGIHGSMVQIARVIVHCYVPGVVMQESLAIENRCALRFHK
LAIEVISRAERIIYASAGDDNEEREEIQHQGSLLKLGLLQNICLKAPERSEERQRVLSLL
WN
Download sequence
Identical sequences K3W9Y2
PYU1_T001773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]