SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T001779 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T001779
Domain Number 1 Region: 3-72
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000645
Family Ubiquitin-related 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T001779
Sequence length 327
Comment protein Name="PYU1_T001779" Note="Protein of unknown function" AED:0.143909988385598 QI:0|0.7|0.54|0.81|1|1|11|0|327
Sequence
MATIKITIKNETSAFTLDTLPSESIASVKAQYLESGKNVGHPNYILLLHKGKELPDEKSL
AELGITDGDVLVHIEAAHEPFRPLNYKALAQAIKTRRRHEEANLKMMKEDNIWAAGQGKM
TLYGTVHRLGLEKSLISTSNAKSPQFVPIQPTSGRAFFNQMSVRVNGCAFHVLPSMEGRW
NGELATVPAQDEGNQVCSYDLIFRDDEGVWSQRQSRTTISGLTSTQHFWIKPVADGILKV
ETDDPSLRGSDITMQELGMNFLIITATSKRSGRPIMVETITGVDSSRRLRTIQRFDETGA
FRSVYVMNETRVVDAVSGAMEKYENVF
Download sequence
Identical sequences K3W9Y8
PYU1_T001779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]