SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T001784 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T001784
Domain Number 1 Region: 231-295
Classification Level Classification E-value
Superfamily Homeodomain-like 1.5e-17
Family Homeodomain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T001784
Sequence length 325
Comment protein Name="PYU1_T001784" Note="Similar to BLH8: BEL1-like homeodomain protein 8 (Arabidopsis thaliana)" AED:0.0797546012269938 QI:0|-1|0|1|-1|1|1|0|325
Sequence
MEMLAALAAFSPLADPTLSSAFEAVGDDIISATQSERQERAIAPFLVAKQQLRQKADEAR
QRLLEDELFQAQNTHNRLLSFTNAAAAGDGSSTVVTRSRGGIGADSAFRAAVERMPAPDT
SSRSAMNEPMIQNVLAKLQHVEATSMQELEHAMAMIDDNSFRQSYQQALGTLQEWSKRKL
LLQQQQLLQQQQQLHQTLRSGFASPLVPSSPSDILLGGATGMAAAARHPVKRRTNLSKTA
KTVLRAWFEDHLHHPYPTEEEKEILGMRGGITIEQVNNWFINTRGRKWKPMLTRLMAEKE
AGECKLYDQMVERIEEPYRRAPTDR
Download sequence
Identical sequences K3W9Z3
PYU1_T001784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]