SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T001803 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T001803
Domain Number 1 Region: 62-302
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, catalytic domain 5.04e-76
Family Folylpolyglutamate synthetase 0.0000111
Further Details:      
 
Domain Number 2 Region: 347-499
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, peptide-binding domain 1.07e-18
Family MurCDEF C-terminal domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T001803
Sequence length 535
Comment protein Name="PYU1_T001803" Note="Similar to folC: Folylpolyglutamate synthase (Bacillus subtilis)" AED:0.00186567164179108 QI:0|-1|0|1|-1|1|1|0|535
Sequence
MVLQRTPAALRLSAKLLRPYTALSHAPFRQAPSPAAFASSTPMEPTSVHQQQQSFEDAST
TATYEFLLQRLYQVNRFTAVKLGIENMKQLNTAFGDPASRYEVVHVAGTNGKGSVSYKIA
KALERSGYKTGLFVSPHVACFRERIQVNGTLISEEQVCETLSEIFNISAQLRIPATFFEI
TTMLAFQHFAKENVDCVVLETGLGGRLDATNIVTPSLSVITSIGMDHMRILGNTVTDIAH
EKAGIMKPHVPVVIGPHAPLEIMRDHATRLQAPLVQVPHDSAFTDDFNAENTAIAREAVV
QLNELAHQAGKSELSVDLESRRVVSALESRPPCRFQVFHIVRPNSGERKVTIVLDVAHNP
PAIEKLVQLLYKRFPDKKFRFVCGFSADKDMRHVISTIASACRQNASETELRDDAALQAR
IHLVKANNPRGASLDEINYALTAPHEGVQSVWTRPFASISAIDEGVAAAVDAARASSDDE
VVVVCGSVFLMAEARQALGFKEPIDSPSLSAVAGAHLSTPATRLAAAKTATAASS
Download sequence
Identical sequences K3WA12
PYU1_T001803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]