SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T001810 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T001810
Domain Number 1 Region: 52-238
Classification Level Classification E-value
Superfamily Bet v1-like 0.00000000531
Family STAR domain 0.031
Further Details:      
 
Weak hits

Sequence:  PYU1_T001810
Domain Number - Region: 270-338
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0142
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T001810
Sequence length 420
Comment protein Name="PYU1_T001810" Note="Protein of unknown function" AED:0.0827116300335664 QI:0|0.33|0|0.5|1|1|4|0|420
Sequence
MVAGNGGSSLFPLPSNFFPRLELAHEEARAFQDWGDRMLQETVDAYHRDQLDSREQKERK
WKPLKQRGGLTAFRRRKAMGGDDEYRYMTTGVIEGTLDEVVRGRYADNTEDFRRVSAVYR
EDLVDCAVLHTIEKETETNPFYYAGFKWMTVQSPGKGLVKNRDVCWYEQMGLTHDRNGKE
IGYTLTESVDLPNCPIFSDCVRAKLSVCYLYRRNKSGGVKVYMRGKNNAGGKVMEYIADQ
KSAELWLRVDAAMSVTHAAVATALVECSKGVRRMNFEKKKCEICEDRIGTIMSAAKECAM
CHRYTCSRCIVKQRVLSPLVDFKAVCKENFCKKCLRFITQVNLREPQSVHDVWAFATSMS
DSSQRSYHHHRIESERKLVLTDPQRRRLGDERRQRPLVPLDAAAAHDFDESNRVYPIIIQ
Download sequence
Identical sequences K3WA19
PYU1_T001810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]