SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T001813 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T001813
Domain Number - Region: 7-51
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00717
Family Myb/SANT domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T001813
Sequence length 782
Comment protein Name="PYU1_T001813" Note="Similar to LIN9: Lin-9 homolog (Homo sapiens)" AED:0.0641455938697318 QI:0|0|0|0.8|0.5|0.6|5|0|782
Sequence
MRDNLGPRWSSKELRTFYILLRAQGGERIQWEKLQEKLPQRSAAMIRALFDTHRGYLALP
GASVDDFCTIAADYHKKIEERSLSRTIAGASGGGGDAVADSMDVKMESIDNEELQAGHDD
VAMHQDQQLDATDDGTAVSSVVNRIRKRDVSLTPTTNAIASATTALQSSSKKDKVKKRRL
DRLLAWDAAGDQLEKQAQMQLQIKSEDEGERALSGPVTSQSLDAGARRSRHAKVRMHVFI
LAVPPKVSAMLIPLLLLFDQRKQKSVVPWRVMQKDPSLLRLHGYLKKLDLPWFYWFYSFV
DVDFFNHNEFVECLERMGLGKVSITDNVIFLQILAAARPIWSSVRASMGRPRRLSQLFFA
QEKAKLESYRMVKRALVAQKAPESWPFTCLAPVEYGANVIVRLANPHRFAFGIVLHYVSG
EDGVCTVKLATSAESEPIVCSLDSVMVLERTFFKEEVPERADSSTTLQQEVSTVNGVSQS
TFAGTTHGNTGASGWRNSPKRRQDTIRAIIAVKDLLHRKEQLVSALTKMNATVRSEREQE
REANRHTGRGSGDSSVGAGHQSLYSDDVLSTASILPSILQRQYAWLVVNLDLTNCHLQDA
LVRLQACARQRVFCSSAPLLFSIYESQGGDDENDAFASRAERETSSDHNGSLSLEHMKWA
VSFLALSQKKAEALVAASIPTTGSSDAAARDTHEAIDTAVPQSQGLPDDTKQLIAMCLCF
MSVVRRGTSTTSPRIPALVTQKLMERLLELLEPRYDGNMDLYAELRAAAEGVIPTLHGAS
SM
Download sequence
Identical sequences K3WA22
PYU1_T001813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]