SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T001815 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T001815
Domain Number 1 Region: 18-117
Classification Level Classification E-value
Superfamily Homeodomain-like 7.86e-28
Family Myb/SANT domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T001815
Sequence length 541
Comment protein Name="PYU1_T001815" Note="Similar to MYB: Myb proto-oncogene protein (Homo sapiens)" AED:0.0558373157502068 QI:0|1|0.4|1|1|1|5|0|541
Sequence
MGKHGSGKNGETGSTYERRAWTRKEDDAIIRLVDEYGTKRWSVISDHLNGENHGTERTGK
QCRTRWLNHLDPTIKKDPWTTEEEQIIEDAQTRLGNKWAEISKLLPGRTDNAIKNHWYSS
MRRTMRRMAKQQNKSLGQSGRAGGGLKASKQHAVAAASSHMIGSSDSPADSPNSMRHVLH
GGFSSPKQGMAFKDCYHMLLKSGEHHDEDPAGAAQDGSGFPGKATLGHHLRSSSTKGVLG
LPGSMGPQKKNTSSKRKRKDLRVCTGVSVGLDAGMFLPDTPRRVLHTQLLLQLLGNSGTN
DDLTHINPHNNSIQVGSKFMDPSTAMHTAKRKKRNGTASGKSAMMSVALQPSRSSNGNEY
NSVGGESQHHLEEQSFNDMDAPFHSFEHLDIDFNEQVAEFFSMPTPMGLHPPHSLRRSPR
FVSPGGFSKHDPQKFSFDDLDFPTDMESNTLEFEMPGENGVLRRSPRLRTDVSVAFPHAN
ANFSLALSQPSPLHKRFAPPTIDVAMQQDTFEFDHSITPTLKSPQLRQWLDGSPKNFIAS
V
Download sequence
Identical sequences K3WA24
PYU1_T001815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]