SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T001838 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T001838
Domain Number - Region: 72-131
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000323
Family Homeodomain 0.096
Further Details:      
 
Domain Number - Region: 5-48
Classification Level Classification E-value
Superfamily TrpR-like 0.00382
Family SPO1678-like 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T001838
Sequence length 248
Comment protein Name="PYU1_T001838" Note="Similar to Pogk: Pogo transposable element with KRAB domain (Mus musculus)" AED:1 QI:0|0|0|0|1|1|2|0|248
Sequence
MSSVPKQKRKIDVATKLRLAQEAKASSINAVAKLYDVARENVRRWIRSEAQLAQLAQQQG
DAPVYRLQGGGRRISYAPMDQELADKVFAHRANGVRVTRRMIAEWAEEAKTRMQVDVVVC
PTWVSRFMARHSISLRKDGAIAPSDSVAPDQQKSKRSVVSAEDKLAIMYFFENSNRDMQK
TLLQFYGPIDDAKVKQVKARNIYNWLHKRDEIAAQAEKERVKKAAAEAAQQTKSAPRGNG
YFESGREG
Download sequence
Identical sequences K3WA47
PYU1_T001838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]