SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T001839 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T001839
Domain Number 1 Region: 3-56
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000932
Family Centromere-binding 0.0092
Further Details:      
 
Weak hits

Sequence:  PYU1_T001839
Domain Number - Region: 75-125
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00116
Family Centromere-binding 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T001839
Sequence length 401
Comment protein Name="PYU1_T001839" Note="Similar to NEFM: Neurofilament medium polypeptide (Homo sapiens)" AED:0.272425549557179 QI:0|-1|0|1|-1|1|1|0|401
Sequence
MAAKRQLLTIAQKNELRRFHASMKPSKITQKELLEWVEMKFGKTIGRSSIGKILSRAPED
EALVSGKRMRMRLSKFLDVEAALLTYILENRDTVAFTDDHLWEKARSVRPVSMSWVQRFK
GRHGISGKNKVRQSVGGCDDGDIREHADNRALMMQALERKRDEILVLAQRAQERQQQGGG
QPSDDGEESEGDEEAETDDDSKQRQQQHSGAFGSRYSEHDAATVRTLPSVERSSRGATAR
LSTSAKPTFAIVSKTTGRVELENRSSTEKSPPVQSPQMEKGMPPPSKKRGRRSSTGTTVT
ATAPSPVPSSAAKKSPSRPEQAPVAPVSNEPAAPDGAQQENSRRTELEEREVELRVEGLR
CDNVLKRIKIAEENMLARKRLRDAGIPQDEIDALLPIARII
Download sequence
Identical sequences K3WA48
PYU1_T001839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]