SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T001840 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T001840
Domain Number 1 Region: 3-53
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000215
Family Centromere-binding 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T001840
Sequence length 375
Comment protein Name="PYU1_T001840" Note="Similar to vps36: Vacuolar protein-sorting-associated protein 36 (Dictyostelium discoideum)" AED:0.150265957446808 QI:0|-1|0|1|-1|1|1|0|375
Sequence
MIVSWVIDMRQAGAPVSSDMLEQKARDVATDFGLSSAQFTPSWQWRQEFFKRYSYPLGGF
VPPTSSYYDQSQVPQRMHAVAEEHKHQQEQHVYVNATANAMNNGSQNWRPQDNANGPYGS
LASQQALLLNMRSPPSTSRFSISQEVHHGGDAQQRMGMDNYHHANQAPPMGYHHHQQQTA
FHPQFQQMQQYQGQYQQQHYQSAHYPGQSQLPQQQPMHHMAQHQTYMSPAAHQVQPQAPP
VAASVAPQPPVHPPPSHVESPAPAQSDSQANAIDSTASSSGAPSMDAAPASTADAVPAPT
VAQSAQSAQAIIELGDQVVEARKREVHLRVEGLRYDNAIKRMKILEENILARKRLKDAGI
PQDEIDKLIPQVKFD
Download sequence
Identical sequences K3WA49
PYU1_T001840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]