SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T001841 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T001841
Domain Number 1 Region: 92-158
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000382
Family Centromere-binding 0.0019
Further Details:      
 
Weak hits

Sequence:  PYU1_T001841
Domain Number - Region: 3-55
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0896
Family Centromere-binding 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T001841
Sequence length 295
Comment protein Name="PYU1_T001841" Note="Similar to cbh1: CENP-B homolog protein 1 (Schizosaccharomyces pombe)" AED:0.214527027027027 QI:0|-1|0|1|-1|1|1|0|295
Sequence
MAQRRQNLSAEQRQQICVHSDTNPKMTQQALALWAKDAFGMAVEPSQSAISAILKRGRDA
KTSGASADGVDGAIAAYAGGVAAPPPVRKVRKKRSVKYPKLDDALLKWVLDCDQHDIRIS
GELVKQKAEAFCDKLKIAKDARPNFSNGWLASFNRRHGLKRYKRDQAYWASEHDDDENDD
DEYDGRGWKHGQRAKNPRFSISKDVNGESKLVELENQNGATALPWNELTEEELEARKREA
DLRIEGLRYDNSLKRIKVAEENMLARKRLKDAGIPQEEIDRMMPLAPSTVAETEI
Download sequence
Identical sequences K3WA50
PYU1_T001841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]