SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T001897 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T001897
Domain Number 1 Region: 42-138
Classification Level Classification E-value
Superfamily Homeodomain-like 3.74e-30
Family Myb/SANT domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T001897
Sequence length 369
Comment protein Name="PYU1_T001897" Note="Similar to MYB98: Transcription factor MYB98 (Arabidopsis thaliana)" AED:0.277402402402402 QI:0|0|0|1|1|1|2|0|369
Sequence
MTPLLAPRSEMPQLSTSNSKPSKLQQRDNMNSPSSSTSRKERKPVCKWTEKEDLLMMKLV
QKYGTRHWTIIGTKLPGRNGKQCRERWHNQLDPAIRKEPWSEEEERILRESHEQFGNKWA
EIAKMLPGRTDNAIKNHWNSSKRRLKRSATPTGGPANKRNKPRADSSTGYDDEESEASAA
SPHSMTADPPSPIPLQGSSSPSAPIQFMPLNSMDLSNIYPGFQHQLVMQAAASMQSGGTP
TGTAYWTPKEAFHLNRSPYSTSNDAWARTPAHVSDWVAAANAIAPPTTTPSNATIEPTEM
KAASFGECTNGKRLLGDSATKPTKSKRKKLKSTSEPQQEELVFVRPSVKTEPRLQLLADA
ALLQFFCHA
Download sequence
Identical sequences K3WAA6
PYU1_T001897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]