SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T001916 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T001916
Domain Number 1 Region: 106-315,353-462
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.9e-90
Family WD40-repeat 0.0000000289
Further Details:      
 
Domain Number 2 Region: 2-76
Classification Level Classification E-value
Superfamily Lissencephaly-1 protein (Lis-1, PAF-AH alpha) N-terminal domain 6.54e-19
Family Lissencephaly-1 protein (Lis-1, PAF-AH alpha) N-terminal domain 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T001916
Sequence length 465
Comment protein Name="PYU1_T001916" Note="Similar to PAFAH1B1: Platelet-activating factor acetylhydrolase IB subunit alpha (Gallus gallus)" AED:0.177047210300429 QI:0|0|0|0.4|1|1|5|0|465
Sequence
MVLTEKQRQDLHQSMLDYLHGMGERFADTAAAFEREAGITKSADGKHAGLLEKKWTSVIR
LQRKVMELENKVQLLEETAKLGNGVVSRRDLLGGGIGGRPRSEFLPRAPPKYALTGHRSP
VTCVAFHPVFSVFASGSEDATVKVWDFETGEYERTLKGHTNAVQAVAFNSAGTLLASTSA
DLSIKLWDFSTDGDYECLKTLRGHDHNVCGVVFAPATAGEDLLYSCSRDHTIKVWEISTG
YCVNTLNGGHSDWVRDVAVSDDGLYLATCGNDRSILLWDLQHMRVLQSIREHEHVVESVT
FAKSGAQELAIEKAHAKKLVAAGAVVAIGNGEAVARSPEDALTTDMVVDVTNASTSSSVR
RVKFLLSGSRDRTVRLWEAFSGTLLMNFASHENWVRCVRFHPCGKYAISAAEDKTIRVYD
LETGRCVRTLDEAHSHFLTSVDVHPTLPLMISGSIDKLINVWECS
Download sequence
Identical sequences K3WAC5
PYU1_T001916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]