SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T001927 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T001927
Domain Number - Region: 4-205
Classification Level Classification E-value
Superfamily Rhomboid-like 0.000419
Family Rhomboid-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T001927
Sequence length 307
Comment protein Name="PYU1_T001927" Note="Similar to TMEM115: Transmembrane protein 115 (Homo sapiens)" AED:0.161836157537263 QI:0|0.62|0.55|0.66|1|1|9|40|307
Sequence
MRLPGTIGLVFLLVLLWVVGVLFTPPNEAGGVLALSVADAILAHIRPWVYVTAGFYNPNL
LQLIVVLPLAFGLAKRVEPDLGALNLARLLVFANTAASFVLFIELFILYIIFREPFYLNT
SMSGFTGGITALLVAFMKPSPYATAPILPGLKLRLYPLVTTLAFTVVSLLGLGTENASIR
AALLGAGPYSFLGGFFGWYYLRFLNKNLDQTRGDASDEFALVTLLPDFFSPVVGPVANFC
FNVVKLCGYFKNRSDKPTSVLPVLAETTDDPIAERRKARAMKALDEKLAKLANKRDESSD
TAPLSST
Download sequence
Identical sequences K3WAD6
PYU1_T001927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]