SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T001929 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T001929
Domain Number 1 Region: 236-277
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.00000225
Family Leucine zipper domain 0.0031
Further Details:      
 
Weak hits

Sequence:  PYU1_T001929
Domain Number - Region: 57-127
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0162
Family beta-sandwich domain of Sec23/24 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T001929
Sequence length 457
Comment protein Name="PYU1_T001929" Note="Similar to capA-1: cAMP-binding protein 1 (Dictyostelium discoideum)" AED:0.0962946313896738 QI:0|0.8|0.5|0.83|1|1|6|0|457
Sequence
MQNPSGAYGANGTGNASHFGSYLQPNATVNAGGAGANSGSANAADLEGDLPSSLPSYMPP
NPQQQQPSLPFFASRPDNPYGPGDGMPSSAKRQAPTGQWKTPPQFLYAANPNAGRPPQPA
AAGKPGGRESESASPSAGMRSMTFQEGTQLFAGTGMEDKSGATGGAGMKLTRQDVVGGIS
AAQFAASTGGLTMDTALLARVSGTDPSRMGSEEIKQIMRTPDLLSIYQKLQEEDDRRQRR
LERNRASARVRREKKKSMVETYEGEVSKLENSLNLLKVHSFGSGQAQDLINALEYSSGEN
LRHALMSKDAKMELMARILGHHSRSTSAIHSANAENQALIATAVENAELFASLRTQLRLT
DEQCRKLHGMAHHVRDEARKLDAIAKCFSALRAHDWLFFPGMETILHQSRNTMTPQQFQR
FLTWTSDNKDVIDQLQVVPSNSPPVSEEDIEFLFVED
Download sequence
Identical sequences K3WAD8
PYU1_T001929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]