SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T001940 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T001940
Domain Number 1 Region: 196-258
Classification Level Classification E-value
Superfamily Homeodomain-like 5.85e-18
Family Homeodomain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T001940
Sequence length 275
Comment protein Name="PYU1_T001940" Note="Similar to KNOX3: Homeobox protein knotted-1-like 3 (Fragment) (Zea mays)" AED:0.295289855072464 QI:0|-1|0|1|-1|1|1|0|275
Sequence
MFALAGAGAARIKQEEEVDDDQMDAVKIEREAHHELLPLIQKLKHMIAHPDKLFAALTLI
DIEDGVSFSERHQLTLKKKTIAYQRSELRGLAATWHRFVDAVGSPSSKNSYLKRVDHMMM
KLALYHMRLWNYICAICIDAVLNMGAAVAESQKHWFTAPSLERHRPAASISPMFESKSSD
ALSQGMIRASSSNLAKRSRLTRHSNEFMIGWFIAHKANPYPSAEERTQIASKTGLTEQQV
RNWFANMRKRHWKPNRLETKKPRCLLDVVLRKHEV
Download sequence
Identical sequences K3WAE9
PYU1_T001940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]