SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T001947 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T001947
Domain Number 1 Region: 4-51
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000152
Family Recombinase DNA-binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T001947
Sequence length 80
Comment protein Name="PYU1_T001947" Note="Similar to tc3a: Transposable element Tc3 transposase (Caenorhabditis elegans)" AED:0.216783216783217 QI:0|-1|0|1|-1|1|1|0|80
Sequence
MAGGTKLTTVEQGQIQVLKAQKLSFRAITKTIARSKTVVENFLKDRHYYASKKRAERVPK
LSERDRRAILCHVTINKSSS
Download sequence
Identical sequences K3WAF6
PYU1_T001947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]