SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T001976 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T001976
Domain Number 1 Region: 418-464,494-509
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000863
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0048
Further Details:      
 
Domain Number 2 Region: 146-345
Classification Level Classification E-value
Superfamily Bet v1-like 0.000022
Family STAR domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T001976
Sequence length 790
Comment protein Name="PYU1_T001976" Note="Similar to Mtmr4: Myotubularin-related protein 4 (Mus musculus)" AED:0.0190442736871753 QI:0|-1|0|1|-1|1|1|0|790
Sequence
MESTGIAFRTSATGSGAALAASRSAGAPSTTSGLPRASGPAALAAPSRLIGGHRASEPIY
LDMDLPSPSPRLQQQQQYQLHPSQQSSRKTHKNKRKSLPKLENLTPPVFMTDEKKEALKE
YAEMRIAAALEKSQAAWDGTSGIFDDPKAWKLHVAKPNLAVYRRRDGPGSDQSISTYRPF
VATGRVTNMTLSDVEYGLYIETTPDERAANAFWFGDYFLDAAILETYETQTEDDAFHFFG
MKWLLTGTLGGVKIMSPRDSVYIQYCKTVISPKGEKVLVKFVHSVGEDVVPLIPDQGDLH
FVRSEISIVYMYHLDVKAKEVQVFAEGKVDPAGRSPSWMANINLSLFAPIIVNIEYIADV
KYISKHGLMYPHDYSPSHDGDDTRSYAPSVSTWIASPMAQSTSARTDSKMSHITAASWVP
DHQRKACFVCFKSFGLMRRHRHHCRMCGEVMCSKCMVTLPLVAPPMFDAEKDAHFPLQNL
PASKKLEDSNQHGFPVVNTFKFCKKCILAARQERRAMVAGVGDYYFNEGMMRHYEQMRAG
LGFGGGDNQLGGEDGEQVHHDDELDDDDDYDIEDDETYSQRIEKLRQEHMAREKQKNLAR
AQSHHAYRSSSNVRLFEEEEDNENDTKAAAPAALVNQQQCDANDSEASYNFDNLLVTDTK
RNLLQDAQLEGKSENISMVATGLPTRETIGGDARKMPLLSTMDARQRSFSIPENFEKMER
TIAEQEALLSTIKQQGEGHKGVITSAEVNAAMKSLAIAAAKTQEQENKSKNLHNQSNQES
NAPTANDDSE
Download sequence
Identical sequences K3WAI5
PYU1_T001976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]