SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T001980 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T001980
Domain Number 1 Region: 335-411
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000101
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.006
Further Details:      
 
Weak hits

Sequence:  PYU1_T001980
Domain Number - Region: 103-288
Classification Level Classification E-value
Superfamily Bet v1-like 0.0033
Family oligoketide cyclase/dehydrase-like 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T001980
Sequence length 608
Comment protein Name="PYU1_T001980" Note="Similar to VPS27: Vacuolar protein sorting-associated protein 27 (Ustilago maydis)" AED:0.250208191384662 QI:0|-1|0|1|-1|1|1|0|608
Sequence
MTSHRSSGFFPAAANELPNIRLTPAQALELRTYATQMMDEIVQEGPGWWRTSVVAAQDDG
WKLESAAPDNFLLIKSAAKKPSRRESSQYDWNPNSSRSSTTSAKGERYSHMATQTNSGHR
FLAHARLTCSQEDIIDNLYSDNTEDVRLRYTSTAGSSCLDSCSLAVIEGATEEDPFWYIG
IKWVALKSPARKLVSSREFVFMEHTRSFINPSGQHVLFRIVQSINVRGYGGKESYFGLTR
AHVEAAWVFFPDDTKGVVEKPVLNMCMKGRVCLQGSLPQWIAQMYVKRFWNAERTFFVRD
KDAPFAMPDLHQTQQRQISSAESTTGSEPLEMATEWVPNDVRTACYVCHRKFQMMRRPKH
HCRSCGEVICSECTNYTNLVVRPTHGDDRTQNNANEPQMIVGKVCHRCIEGKGTRRSMSG
TQDSIVEPSRGSMSGNSEIVYDVPHSRGPSSQSSSNRSQGSGGEYVAGVHPIARMSSVDG
SYCNGSDGGSLESDDDIQFYPGMPVNYATLAQPDLASSVSRFDADHLFIESAPPLRMSGK
YVADSDSVALVARSNSTTSSASSSVVLAGGERILSIAEVKHSIAEQAKLLDDLQRALDAH
TVNKSRSR
Download sequence
Identical sequences K3WAI9
PYU1_T001980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]