SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T001990 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T001990
Domain Number 1 Region: 109-221
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.9e-20
Family Canonical RBD 0.0023
Further Details:      
 
Domain Number 2 Region: 74-101
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000000445
Family Ran binding protein zinc finger-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T001990
Sequence length 236
Comment protein Name="PYU1_T001990" Note="Similar to SPAC25G10.01: Uncharacterized RNA-binding protein C25G10.01 (Schizosaccharomyces pombe)" AED:0.501487287491587 QI:0|0|0|0.16|0.4|0.5|6|0|236
Sequence
MNVLASFRPLQARIILNKGSTVDSPNDPLRLDHRPVAIGFTENNRPTSDRWHGSGENRAA
TFTDSATRGGPRLDWVCTQCHGTNFARRSSCFKCDAVKSEDAKEIPAGQIYHLGHRDGPP
HGPPGSGSMYGGYQENERDAPSNVLVVRMIPEDVEEGELHVAFAEFEGVQDIRLIRDRLT
NLSRGFGFVEFADVESATKALNGSGDLRIQGSLLLLSKRNGRLPTDTEPTNKNGHR
Download sequence
Identical sequences K3WAJ9
PYU1_T001990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]