SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T002012 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T002012
Domain Number 1 Region: 286-392
Classification Level Classification E-value
Superfamily BRCT domain 0.0000000000000955
Family BRCT domain 0.0049
Further Details:      
 
Domain Number 2 Region: 413-513
Classification Level Classification E-value
Superfamily BRCT domain 0.00000051
Family BRCT domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T002012
Sequence length 514
Comment protein Name="PYU1_T002012" Note="Similar to Brca1: Breast cancer type 1 susceptibility protein homolog (Rattus norvegicus)" AED:0.125289765193961 QI:0|-1|0|1|-1|1|1|0|514
Sequence
MRNHNANDDDEDDEDEDEGSQTQMPPMTMDSPDLLALSTNSGYPLSRLDEFNRTGVIGGS
AFPLSGLESAASRRRSGLEEASHFTNGKQKQAKRQVVLSSPPRILSRKRAVSVANSQQQL
DDDEDEDGDDEEMQGNEEDTQDVDDSQPLPGASTRVRYDTYSRSAVVVANGSHAQSNHPD
VLTQRRKKLRASDDFEGAITAFHSKQKTALPGDAVQPVARLASPSLKSPKGILNATMMRN
VSVSGTSIASPGAAMLSPTPTSRPPLAQQSTSARQLVHELRTSRNFTLISTDLDRIDCKK
IVTACSLLGGRFGPRFDLRPDPVTGVLTSTVTHLIAKSVPPVVNRRCKRTAKYMRALAEG
CIIVDYSWVQASLDAGKWLREDEFEILGDAYSDSVGKPHESHLRRMQTGRRNDIFQMFRF
VLLCDETEFDWQVGSLRGVVENFGATVISEAKYLCMSEERKATKTQVGIVSKCTTPVDAK
DRYEQHQIPIVRVTWIFDSISHLEVLPFDEYYPY
Download sequence
Identical sequences K3WAM1
PYU1_T002012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]