SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T002068 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T002068
Domain Number 1 Region: 67-80,131-210
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.15e-23
Family Canonical RBD 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T002068
Sequence length 294
Comment protein Name="PYU1_T002068" Note="Similar to Refbp2: RNA and export factor-binding protein 2 (Mus musculus)" AED:0.0177059276366436 QI:82|0.83|0.71|1|0.83|0.71|7|286|294
Sequence
MSSILASLDMSLDDLIAQKKKAPNPDSRAASRGNGNGNGKPRSNNKADAGSAGPVRGRQQ
RKRSGGARNQPYGRSRDGGDSDAMDVEDDGPQSGGKNAGSKKRAVVVKKQQGKGGKKGGS
ILSRLGGSTKDAGSPGTKILVKNLKFDILEDDVRELFGTVGEVKKAEIVYDRSGRSKGIA
RVWFARRSDAEKALKQYDGRTLDGQPMQLSLDDDANVRKGLFGTALRNDKDVKFKVSFGG
NSGDKDSQQKGRDGGRGGRGRGRGRGRDGQSRGNGPSKSAEDLDNEMDTYMKDS
Download sequence
Identical sequences K3WAS7
PYU1_T002068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]