SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T002111 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T002111
Domain Number 1 Region: 40-182
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.02e-31
Family Ankyrin repeat 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T002111
Sequence length 196
Comment protein Name="PYU1_T002111" Note="Similar to RF_0381: Putative ankyrin repeat protein RF_0381 (Rickettsia felis)" AED:0.139180166711041 QI:0|1|0.66|1|1|1|3|31|196
Sequence
MDDPLCNIPSAAVTGDELDPLASWRTCRQDSLKMQALQRADLYGGEPLLQSAMFGNLESL
ESLADEGVGIDARGSSGATALHMASLLPQGNGVVPFLLANGAPVNAIDEFGFTPLHRFIQ
SQNVEGAAMLLYSGANLTIYAPGGETPLHLAAYENSRELAQLLLAFGANPFARNDRGATS
FEVGLFDMLVPPHHMT
Download sequence
Identical sequences K3WAX0
PYU1_T002111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]