SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T002160 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T002160
Domain Number 1 Region: 423-667
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.29e-60
Family Protein kinases, catalytic subunit 0.00022
Further Details:      
 
Weak hits

Sequence:  PYU1_T002160
Domain Number - Region: 230-291
Classification Level Classification E-value
Superfamily RING/U-box 0.000927
Family RING finger domain, C3HC4 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T002160
Sequence length 676
Comment protein Name="PYU1_T002160" Note="Similar to Sperm motility kinase Y (Mus musculus)" AED:0.107727008373692 QI:0|0.66|0.25|0.75|1|1|4|0|676
Sequence
MQQQQHHVRNARGHAKWVVEASSALASAAAGDDDDNDDEDLRASDAAQSAQQRWRQRYSQ
SVDFSRPDRTAFIGSKTASSRQVNLHAYNGDISRRSAYVETKIGGHALDHKRFFYPDWQQ
IRQPLKTAAFRVAADVLWGSATSSERSSPAYQITKHDVLNYAATKIGGHPLDHVPFINRG
QPSRPLLGYVAPRLSISAQPVFPRSSSVILRATLEQQTRVLQSIGRNPAHLYDCSRCLRM
RQSARVQLVCSHSICSACVSSKTMNHVEAGEFCFLECSQCSEFIAIEAIVFINNYAVRIN
APMVRTLAEFVKIIGNPKENVRTPSASSMMANAMSGASSSPGWKYGGIVAVLAFAAGKLG
SRQSKNRMKKAQHAAIEVEEDSNVKDVATLAKHGGTVEGTIENGAIRWQKRVVGLAPPSR
LLKYKFVRTLGIGNFAEVILVKHRKGKLSVLKESDKLQEAVNEIRILSKIQSPYVVRIFE
YFIEEVGHRHFAYIDMEYCDRGDLVKLLTEKGALDAATFESLFRQLCLGLQEIHAHGIIH
RDLKPGNVLLTSDGIAKIADFGVSTCLESDLLTHHAAGTVAFMAPEVRRYFLGEDVSYDT
KADIWSLGALAFAMLTGNPEPRVATRPLDELIGSLREQGIDEKHVSLVEKTLHQVPSGRA
NLQELLSLIPVMNSKL
Download sequence
Identical sequences K3WB19
PYU1_T002160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]