SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T002170 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T002170
Domain Number 1 Region: 379-663
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.45e-77
Family Tandem AAA-ATPase domain 0.0000438
Further Details:      
 
Domain Number 2 Region: 152-377
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.8e-60
Family Tandem AAA-ATPase domain 0.0000208
Further Details:      
 
Domain Number 3 Region: 923-1047
Classification Level Classification E-value
Superfamily Homeodomain-like 3.76e-30
Family SLIDE domain 0.00032
Further Details:      
 
Domain Number 4 Region: 868-921
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000478
Family Myb/SANT domain 0.0046
Further Details:      
 
Weak hits

Sequence:  PYU1_T002170
Domain Number - Region: 735-804
Classification Level Classification E-value
Superfamily HAND domain of the nucleosome remodeling ATPase ISWI 0.000288
Family HAND domain of the nucleosome remodeling ATPase ISWI 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T002170
Sequence length 1109
Comment protein Name="PYU1_T002170" Note="Similar to Os01g0367900: Probable chromatin-remodeling complex ATPase chain (Oryza sativa subsp. japonica)" AED:0.0610851825137539 QI:0|0|0|0.5|1|1|2|0|1109
Sequence
MDEDMDGDDAENENDEDEEGDEADASEAKPEEAALTKEERVALLKEEEAVLQQQRDLQSK
SLEAVKQNLAADTDWAKKSIAEKKMAFLMAQSDVFTSFLMGGSSALGKEMAKSKTAAKDK
SNSRRNKSNSKSELEDAEAVAEMDESRFTRITQQPNCIKFGTMKPYQLEGLNWMIRLHDS
GVNGILADEMGLGKTLQSISLLAYLREARGIEGPHIIIVPKSTVGNWMRELKRWCPSIRA
FKFMGDKEERARQRETVIKQDFDAIVLSYEVAIIEKAVLQKIKWKYLLIDEAHRVKNEHS
KLSTVVREFKVEHRLLITGTPLQNNLHELWALLNFLLPDVFTDSEDFDSWFNVDEEKGQE
NVIKKLHTVLRPFLLRRLKADVEHSLPPKIETKLYVGLSEMQREWYMRVLHRDATHLNAI
GGSDRVRLLNILMQLRKVCNHPYLFEGAEPGPPYIEGPHLWENCGKLTLLHRLLPKLKAQ
QSRVLIFCQMTSMMDILEDYMRYHSHDYCRLDGSTKGEDRDFMMEEFNEPTSTKFCFLLS
TRAGGLGINLATADIVILFDSDWNPQVDLQAMDRAHRIGQKKTVRVFRFITDGTVEEKIV
ERAERKLYLDAAIIQQGRLAQQNRKLSKDELMTMVRFGADEIFNARGSMITDDDIDAILA
KGEERTEAMKAKVAADMQHNLANFSLSGENANGVSSLYEFEGEVFSKDASSSGAILPSTF
IALPQRERKANYNEDEYYRKQAGIVKAKKVKKDDAPKIPVVHDYQFFNQEAMVTLLTKKN
QIEIRRKELLRQIKEAKNEEQRLKPKPKKKTGEAGGNEEAVSASNSAGEEEVDENLKSVQ
LEKELEEIEMDPKDANELERLESEGFVDWTRRDLKQFITSCERYGRADKERVCAEVAQLV
SKDMVQVERYFDTFWKRYTELKDHAKYIEKIERGEKRLERNEVVKQALARKCSRYSNPLR
DMKLHYPSGYKSKGYILDEDVFLVVMMNKYGPLEHWSEIRDEIRKAWQFRFDWFFKSRTI
GELQKRGEMLTRMIEKENEELKSKNSKDEEDLVKKAKKPSSSSSSKSRSKSKSKSSSSSK
SSTTTTSKSKKRGSSSVSSSSAAKKHRSK
Download sequence
Identical sequences K3WB29
PYU1_T002170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]