SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T002182 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T002182
Domain Number 1 Region: 2-119
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.85e-31
Family Synaptotagmin-like (S variant) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T002182
Sequence length 284
Comment protein Name="PYU1_T002182" Note="Similar to DDB_G0277895: TM2 domain-containing protein DDB0214922 (Dictyostelium discoideum)" AED:0.270523979204393 QI:0|0|0|1|1|1|4|0|284
Sequence
MVELHVRAVCARNLLDKQTFGKQDPYCKITVRNRTFKTRVHDNGDKSPVWNERFTFDAHD
PQLDQLVIEVKDKNFTSSTLIGEVRLPVNMFLHGNLVDEWYTLNNGNKRAGEINLRVQLI
GPGIGGGKGEKAAVPAPVAYAQPAVVAAAYPAPQQAAAAYPPQGTAHAYPPQPQYAQQPH
YPPQQPYYAPNQQHYAQPQHYPPPPQQGYAYPPPQPAPVMYGAPAPVYGAPQPVMYVQGA
PGYRDHHHHHGGHRRRGSGGDAAEMALGVGAGVLGGALLADVLF
Download sequence
Identical sequences K3WB41
PYU1_T002182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]