SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T002234 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T002234
Domain Number 1 Region: 376-464,521-592
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.66e-27
Family Canonical RBD 0.0001
Further Details:      
 
Domain Number 2 Region: 233-346
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000149
Family Canonical RBD 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T002234
Sequence length 601
Comment protein Name="PYU1_T002234" Note="Similar to U2AF65A: Splicing factor U2af large subunit A (Oryza sativa subsp. japonica)" AED:0.0686624813306441 QI:0|0.33|0.25|0.75|1|1|4|206|601
Sequence
MAGRGRELTLPAWMKKQQQQAQAAPPPASHAPPPHFQQPPASTIGFHQYQQQQHFHAPPT
APVVPQQFADAPEQANGADRNGDSKHDVKKEDAGREKSGSRRSRSRDRRDRSSSRGSSRR
KDRNRRRSSKSRSSKDRSLPRDKDRSRSRDRRDHHRSRDRSDRRRSRRSYSRSHSRSRDR
IVRRRKKSYFDVRPPGVTEENAAAYAAQAILQQNMAALSGAVGPASFGPPPPPIAPPAHA
IVPGVVASHTFGGNSQQTRHARRIYVGGIGDVNEAEISEFFNDVIDRALGERQEGGAVVS
VYINRERHFAFVELRSIELTTACMNLDGVSFRGQPLKIRRPNDYNPSTVPKDLGPIPTLN
LAALGIVSTTVSDGPGKVFIGGLPYHLNDEQVKELLQAFGPLKSFHLVKELNSNLSKGYG
FCEYVDINVTDSACLGLNDMKLGDKTLTVRRAMSQENAKAVASAAGTVNSGLEMGLNPSH
AALQAMNLAGFGIPSMPLGTPTRVIVLLNMVTPEELEDEEEYADIVDDIKGECERFGRVN
SIVLPRPRDGFYSAVGKVFVEYGDVPSAQAAAAELHGRGFSNRTVAVEYMDEHKYARRDF
S
Download sequence
Identical sequences K3WB93
PYU1_T002234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]