SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T002256 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T002256
Domain Number 1 Region: 11-184
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 1.05e-45
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.00000341
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T002256
Sequence length 198
Comment protein Name="PYU1_T002256" Note="Similar to HAL3A: Phosphopantothenoylcysteine decarboxylase (Arabidopsis thaliana)" AED:0.256097240127338 QI:0|0.5|0.2|0.6|1|1|5|0|198
Sequence
MRMEVATPIRKPRILLCASGSVATVKVPELALKLAEFAEVKLVVTKAGDFFLQKVSEYNP
SAWGAFTARAEPIEVIRDEHEWDAWRVVGDSVLHIELKDWADVLLLAPMSANTLAKIANG
LSDNLLTCIARAWNVRKSFVYAPAMNTDMWDHPVTARHLRTLGEFGYEMIPPVEKMLACG
VVGKFSRKGNLSRWARRR
Download sequence
Identical sequences K3WBB5
PYU1_T002256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]