SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T002276 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T002276
Domain Number 1 Region: 201-473
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 5.04e-33
Family ATP-dependent DNA ligase catalytic domain 0.0017
Further Details:      
 
Domain Number 2 Region: 480-634
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.48e-23
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.0011
Further Details:      
 
Domain Number 3 Region: 877-891,919-999
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000275
Family BRCT domain 0.065
Further Details:      
 
Domain Number 4 Region: 669-793
Classification Level Classification E-value
Superfamily BRCT domain 0.00000465
Family BRCT domain 0.069
Further Details:      
 
Weak hits

Sequence:  PYU1_T002276
Domain Number - Region: 21-225
Classification Level Classification E-value
Superfamily ATP-dependent DNA ligase DNA-binding domain 0.000837
Family ATP-dependent DNA ligase DNA-binding domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T002276
Sequence length 1001
Comment protein Name="PYU1_T002276" Note="Similar to lig4: DNA ligase 4 (Dictyostelium discoideum)" AED:0.160678642714571 QI:0|-1|0|1|-1|1|1|0|1001
Sequence
MDEDKATMAKAQDAQVAAMKLSFAGCCRMLDAVEKTPKSDAKLRLVFSDALRQELGGGGD
MYPLLRLLLPQLDRERTYNLKEKKIAKIYIDVLGMASESKDAQKIEHFNDPTVVQSKAVG
DFAAVLYDILVYRSLAGNKKYQHTVGVVNELLDQLVKADDNAAHKKVFMRLATEFPANEQ
KWIVRIVLKDLKIGLRHERVLNFIHPDAMEMYNHTSDLHKVCVDLRNSSVRYVPKIEPFQ
VFSPMLAKRVDFGECTTAINADVFAMEPKLDGERITCHVQGNRVEFISRNGINYTDNYGP
FMAPYVLSQVVPGVNCIFDGEMMVWDNLEYRFREFGLLKNVANALRSGENTSRWLCYVVW
DVVYLGGGEKAEQLIHEVYKGPGEVSAVMGLPQYARRQLLERLLKPLDHRITIIEQTLVN
SQSAKERHELVMAEVDKQVSNGGEGVILKDINSHYMCGESSRKTKKWIKLKPDYAGMTTN
LDVLIIGGFYGTGRRRSGDVSVFLLGVLSRSLDEAAAEEAVKLGEPCPVVYTFAKVGTGY
NLEELEDLRRDLEPHWQLWDNDNIPAHLNGWKPQKSDLKPDVWIDPRHSKILEVYGFELT
FTTLYQTGLTIRFPRCKAIRNDKPWYQCMNVQDLNTARGSIFNKRAADVALGQKKATKRI
TKRLTSSSRQPVGGIVAHFSQAKLDNVELKHDVFEGKEFCVLPGKYEKPVDFEIPSEIMG
EHERNLFKQAVEKLLHSYGATIVQNPIAETTNFVVAVSDAGFKVANLVKQGRFNIVYLHW
VVGCMASSRLLPLKARDFVFATESTRALLAKEYDQFGDHFTEYVKPDDLRLIFKEVARVK
GISASMKFHADPVEHWQTKIKALAAEEEEAMECEFTVLAHCVVYVDRYVEIHAARECLPS
TNTAERTATSPVELDPFGHMKLLEQQIRLFGATVVCKIDADVTHVVLNSASDRERIGKLQ
PIVRSLRRLHPKEPAPVSKEWAEECAKQRTQLPVDDFFIPV
Download sequence
Identical sequences K3WBD5
PYU1_T002276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]