SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T002357 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T002357
Domain Number 1 Region: 674-861,916-1225
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.71e-64
Family Tandem AAA-ATPase domain 0.032
Further Details:      
 
Domain Number 2 Region: 32-121
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.000000262
Family Double-stranded RNA-binding domain (dsRBD) 0.012
Further Details:      
 
Domain Number 3 Region: 455-564
Classification Level Classification E-value
Superfamily UBC-like 0.000000476
Family RWD domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T002357
Sequence length 1471
Comment protein Name="PYU1_T002357" Note="Similar to DHX57: Putative ATP-dependent RNA helicase DHX57 (Homo sapiens)" AED:0.0130530173140009 QI:0|0.5|0.2|0.8|1|1|5|0|1471
Sequence
MGRQPGHRQRGAGTVTVSRGEVERHGVLVKEWQRTPMQLLHEYCQSKKRRNPFYPSAKAP
DGKFRVRCVLPDDKNSAKDLKFCPEQAFGTLDEAKHCAALLALHHVEPLRPFEQKLPDPY
RGLWLAMTTPAAPASAAANSKKSKAPAKKAGASAATAAASAPAAAPKDENEMDFWANVPD
SPKSKAGGKAKSFPKELTADRKFASHAEFEKAKLEQVQARNKKIRQRENRERANLHKDVF
MSATCRDMIENVLRQLGTITTAATNSEGSASATSSSSVAATQDGESAHAAFYESVTRQLK
EIGFQQKHVQGALQACTKESDHSDDEYMTIILDWLCLNVPEGDLPKGFNPEGTQLDVVLS
AKTAESKADSEQTGMIMSPVLVQRLMKYGYDRRDAISIANEYLRTHPEDAGNESPSADIM
FALLQQLYPHQLKHFEIGAAFVADGVPDDEELALMRQDEIFALEAIYEDRFVSQPLFPAM
DNDESQVLVLQVSDDVQLEIFFPSGSKYPFELPVIGLTSSNPALQPYLLFTCGSVLKSCA
STLGDPLIYDICVAVDTILGECAQRKNNPKKIVLLPHAKSSNAKSSSSGESKAKSAPPPA
SVAADSKSGSKGKKDKKQNANKKRFSERKVDVAAMNSMSEKLLQLRQKKDSNPEFQKMIT
SRAKLPAGAEKENVIQYLKHNQVVLVCGQTGCGKTTQVPQFILDDYIDSNRGGECQIICT
QPRRIAAIGVATRVAQERCEDIANIVGYQIRMDAKKSANTRLLFCTTGVLLRRLLTDRSL
SGVSHVIVDEVHERNIDTDFLLSILRDLLPKRPDLRLILMSATMNSSLFVNYFAAVSKSP
CPVLDIPGFTYPVQCNFLEDVLAMTSYDVPKKLLVEKKKKQSGGDDGADATKEKAKRVQD
LTPQELVQIIDDSRIDYDLVVHLVTHLVVNNKTDNGSILIFMPGTAEIKRVMEMLSHTSQ
IANQLLVLPLHGSLSGADQSLVFRPAPHGKTKIIVSTNIAETSITINDITVVVDCGKVKE
MVYDNRQRRSQLLDCWAAQAACDQRKGRAGRVQAGTCYRLFSRKRFDAMEPQLSAEIHRV
SLEQLCLQIKKLELGSIKGFLAKAIEPPKEEAIDAAMQELVEIAAFKQVASANTTTATED
EQVRLTPLGNHLAMLPLDARIGKFLVYGSILRCIEPVVLIAACISSKNPFLLSMSDPELK
EKQESLKKELNGNWKSDHLLLWKVLERYAPLKGQKLKRGFCKDFGLSFDTMESIVDLKNQ
YLQQLGDIGFYDSYNAESLNSNSSVPRIIKAALCAGLYGNVAQVVYPEQKYFQSAHGVFT
EKHDAKKIRYFIKAREEAETDAGNNKNYHQRERVFLHPSSCNFVQTQYDSPWLLYTELVQ
TSKVFVRESTMVNPYALLLFGGKLEVVHEKNLLVLDKWIQFHAVARIGVLIKAIRKHLDQ
LLMEKIEKPALDIAQSELVTAISHLLKSEGM
Download sequence
Identical sequences K3WBL6
PYU1_T002357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]