SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T002384 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T002384
Domain Number 1 Region: 520-606,772-1036
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.76e-71
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.00027
Further Details:      
 
Domain Number 2 Region: 7-116
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000394
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Domain Number 3 Region: 161-206
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000564
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0041
Further Details:      
 
Weak hits

Sequence:  PYU1_T002384
Domain Number - Region: 291-395
Classification Level Classification E-value
Superfamily ARM repeat 0.0201
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T002384
Sequence length 1043
Comment protein Name="PYU1_T002384" Note="Similar to pikD: Phosphatidylinositol 4-kinase (Dictyostelium discoideum)" AED:0.293103448275862 QI:0|0|0|0.33|1|1|3|0|1043
Sequence
MKAPRASCEGYLTLRTSPSSPPPMLRRYCFLVGTCFYYYSTQEDAYHMLRLKGEVDVLGV
QEWDGKGNMHIYQYGFLFATAQNKVFYAYADTAMDKEKWMRAIQMTVETNMPRLPAIFTS
HALTTLDSLSPSGVSVPVTDAETKCKCPHCKALEAASQTPATTMLYKCHSCDTLFCEKFT
THKIPLPHRSFYYSKRVCDDCYEAQMFLNYLKAIVERLKAGICLYPKPLNPDTPIELIMP
QRPSHTEAANIAINMLKVGLITAEECEEILLADRRYLDHTLDQPEIPLDLKILALHREFR
SRTFSVYRAVILLHRHLDSDPLLFKPIVEKLLHFSYTRINQVEFYWPQIVHAYLTVPMFD
FEKIFWLDELIFSICSRSIHLALLLRWQLQGALEDAFDPNAPKDMQDKYARVVRLMVEVE
QEVVGTDRATLLSRSPSERSRRSRLPMPTEEQLHLIEQTTAEIHLLTPKHPGLLTGAENS
DDNETPMSIIEEDMVDNQPTSLFNGITRRMSQAEKSVLSQYFADECDFVQQITDIAEVLR
FVPSIQERKKRLPGYLEKLRLPPMAYVPLVKATDPFERIVRIPTKEGTAFSTKARVPILL
IFEVIRGNFFPPEQPALSPNSPHRKSYLGSEAISSSGVEYIEDDEVGRLIHHQAPEGFVD
ADESKQDEELRNQPNASAPRINPQVPETPIDVASNLATPATAQSRLNPLDEESDVSPNDD
RAVSELDMDMSSVNLSEEVIERENDRRKDLEAAFGESWSSKRKRLLEASPYGHLPGWDIV
SMIGKSNDDLRQEVFTLQLIQKFIEIFKAAKLPIWLRSYRIIATSSSTGLIETLANAISL
DGLKKREGYVSLLHHFEKSYGPVNSPRFVEARRKYIQSMAGYSIVSYFLQIKDRHNGNIM
LDNEGHIIHIDYGFLLGIAPGGSFSIETAPFKLTYEMVETMGGTDSEGFKEYVKLITMGF
LACQQHCDEICDLVDIMSRQSPYPCFAGKDVSYILLRLRSRFKLTLSKQETVAHVLYLVR
KSNSNYSTRQYDNFQRMTNGILP
Download sequence
Identical sequences K3WBP3
PYU1_T002384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]