SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T002524 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T002524
Domain Number - Region: 25-73
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00215
Family Myb/SANT domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T002524
Sequence length 194
Comment protein Name="PYU1_T002524" Note="Protein of unknown function" AED:0.21731969653318 QI:0|0|0|0.66|1|1|3|0|194
Sequence
MPSPMQQPPQTPEFLPSISTSVVYSTVHAVWSPHEMQIFHRGFAEFPADKYDNVTRYIKI
AAMLPGKCVRDVAFKAKALSVSQEKMSMNRDHFSKRMKIEPYQETPTLAFPIPMGGDDPE
DAQLNALLQDNMVMMNTMRSNLLSGKLDDNKEPMLKFRDNCHTVLNTLGDICNSIPPLPV
QLDTSLISSPRNSQ
Download sequence
Identical sequences K3WC33
PYU1_T002524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]