SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T002534 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T002534
Domain Number 1 Region: 611-698,866-1129
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.63e-71
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.00013
Further Details:      
 
Domain Number 2 Region: 113-228
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000101
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 
Domain Number 3 Region: 289-349
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000299
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T002534
Sequence length 1137
Comment protein Name="PYU1_T002534" Note="Similar to pikD: Phosphatidylinositol 4-kinase (Dictyostelium discoideum)" AED:0.199227632756775 QI:0|-1|0|1|-1|1|1|0|1137
Sequence
MATALHSSRAPGRDETALLRLKKEPLGAADSGVEYIGSEAAQQAQDESEAKTPPMTTTGE
KLLPLAPEARYRTASTTLEAGSTGDSSQKKQQTMELEMALATAAATFGEHGDKGAYFEGY
LRKRYSTSMYMGSWRYCILQGNRLRWYMTQELAHADSQLRGEVWVRDVEPWNGQGSMNTY
PHAFALRTASHRLLLCSSKSVDEKDEWLANLQKCIQHIKRHDGGDRPHTHIHHEGGSENR
RIVPEDMLRATNAESVGGVSFAESIPRSPAMPVLGAAVPAPTDTTSATSESECTRCAIRF
GAVLARRYVCGSCAKPFCSRHCSSYVKLHHLGLRSARRCCMACARRQDFILYLSSLSRFL
NSTNTGFPNMDAVILQCGPQFDTSDLFERTIEKLRRGPMSLVKTIKILYQTRKKPHLFVV
ACERLPFYVENCIDRVENLWYQILHLFQCCDADPESSAIQLFYLRRYIRAICRRSPRIAL
QTIWHVQASVGDASGLHPHSLLSLLGFVYPMSEGNLSLWREHLLAQYPDHQRDEILSGLK
LAYSQSEALIERENGSLIERWLNATTVPDFEASATELASSGIELCEFQTSILYESLSVDD
WARGPTQIEALVFDQVNFVQSLADISERLRHVQPVQKRGMYLEIELKQMNDKLLQSALYP
LCTASDQLYRVLRIPPNEGKVFTTKMRAPTLLFLETVPVNATTLVGSNDRFRPFVSTSHP
RNSTFFETLPPSFAILGDGSSRDSLVSSTESSNDAFATPKMHKGRGGSQQNYLEDMDSMS
DDATNGKSNTASALGGIIGRHMTFPGADYNRDRGDSTNASEARGFSLVSTNSHKRHNVDN
IVYDSKVYGESWEERKERIRVESPYGHLPGWTLFSIIVKTNDDLRQEVFTMQLIKKFQSI
FEYEGTNLWLRTYRIVATGASIGLLETINDACSLDHLKKNFPGGNLFAYFKSVYGEPSTP
SFEAARKNFIDSMAAYSVVSYLLLVKDRHNGNILLSTEGHIIHIDFGFILGIAPGGRFSI
EDAPFKLTVEMVEIMGGMNSPGFERYHQSMCDGFLALQKYQSEIAALLQTTGQHSPFPCF
ESAKLAKVITDMRDRLCVGLNRQQVRRRVDHLIRKSYNVWGTRQYDAFQLRSNNIHP
Download sequence
Identical sequences K3WC43
PYU1_T002534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]