SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T002540 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T002540
Domain Number 1 Region: 205-471
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.19e-77
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000639
Further Details:      
 
Domain Number 2 Region: 3-166
Classification Level Classification E-value
Superfamily YbaK/ProRS associated domain 4.45e-37
Family YbaK/ProRS associated domain 0.00016
Further Details:      
 
Domain Number 3 Region: 472-600
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 2.29e-32
Family Anticodon-binding domain of Class II aaRS 0.0000796
Further Details:      
 
Domain Number 4 Region: 603-699
Classification Level Classification E-value
Superfamily C-terminal domain of ProRS 0.0000000000000196
Family C-terminal domain of ProRS 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T002540
Sequence length 699
Comment protein Name="PYU1_T002540" Note="Similar to SPBC19C7.06: Putative prolyl-tRNA synthetase C19C7.06 (Schizosaccharomyces pombe)" AED:0.108571428571429 QI:0|-1|0|1|-1|1|1|0|699
Sequence
MAEQEVMAALAALSIAYETHTHKEVPTVEDLVAELGHLDGLLTKNLVFKDKKEGLFLVTA
ATSTTVDTKLLGNKLSAAGIGGKYNLRFATEDVLETVLKVKKGSVSPLCVMHDEKTEVRL
VLDKALVDAKVLHCHPLRNDLTYSLAPEALLKFVKHYKHEPIIVDFAAVEKAAPVAKAAK
GAKPAAAPKKHENKSNEGVSVTKSENFADWYTEIITKSGMIDYYDISGCYILRPYSYEIW
ERVVEYLDSRFKSIGVKNCYFPIFVSSEKLQKEKDHLEGFAPEVAWVTKSGDSDLKEPIA
IRPTSETIMYPAFKNWIRSHRDLPLKLNQWNNVVRWEFKNPTPFIRTREFLWQEGHTAHA
TKEEADTEVRQILDFYAGAYEELLAVPMVKGTKSEKEKFAGADYTTTIEGFIPSTGRGIQ
AATSHHLGQNFGKMFGISAEYEDGKKLIPYQNSWGFTTRSLGVMIMIHGDDKGLVLPPRV
APLQVIVVPIPFKDKDEVDMIYSKADEISKLLLKAGVRIEVDTRRVYTPGWKYNHWELKG
VPLRFELGPKDIAKEQVRVVRRDNGAKADIPIAELTTKIPELLEQIQSDMLERARQERDS
RIKKVTEWKDFVNALQESCMVLTPFCNETEWEEVVKTKSREESLALMGLAEEAENTATSA
AAKTLCIPFEHNVDPIADDLKCFVSGKPAKCWILWGRSY
Download sequence
Identical sequences K3WC49
PYU1_T002540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]