SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T002548 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T002548
Domain Number - Region: 98-151
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.00551
Family Leucine zipper domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T002548
Sequence length 191
Comment protein Name="PYU1_T002548" Note="Similar to kapC: Putative transcription factor kapC (Aspergillus oryzae)" AED:0.278978280141844 QI:0|0|0|0.33|1|1|3|0|191
Sequence
MLMEHSVLRSTWPISDQEYPVGLHSSIEQQHFPTLMPFSSYSAFPPPPTRFKDASPRTFG
SIYPPSSSSSTHSPHMALHSLPLSLSIPRPSGSRKASEEERKAKHREAQRRFVKRKKAEM
VQLKQLAIELELQYKLLELMSEQSALAKENYALENDIATTRENATHSEKKTDVKEELPPI
PVPNLSFDFEW
Download sequence
Identical sequences K3WC57
PYU1_T002548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]