SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T002583 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T002583
Domain Number - Region: 73-118
Classification Level Classification E-value
Superfamily F-box domain 0.0258
Family F-box domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T002583
Sequence length 646
Comment protein Name="PYU1_T002583" Note="Similar to Rv0628c: Uncharacterized protein Rv0628c/MT0656 (Mycobacterium tuberculosis)" AED:0.0327286531630467 QI:0|-1|0|1|-1|1|1|0|646
Sequence
MTRAFPASPPPPTHHKRPQHQFQKMKKPSAARKNHHHFQQHAGIETQEGPSSQGREKLTA
KKNSSTSKGKHGAKSKAKMPPSSFQKLPQEMVLLLFPFLTWKDTAAMLLVDASLSRIVLE
TKKAYSEWKNTVCIADNADASVELLRQRNRGCLLNARFAPNLIMINVGSGDSIPFKTGGY
WKHLAQMLESEKLIPRECPVMMLYTPLGVMGTGSEETPNNVREYEEELGDDGDEPNKTVT
LSITVAHLPGTSVETAVFDRKWLRQQARGRGDEPEYPFTTIENAGGAMEDTNSGLSNDQN
FPSFLLFSVNANSSEELAPIVSKWHPGASIVGGIFPFADRCIPMAVYKSGLVSSAAKDVP
RQHKLSRKAKQSASSSSSSAAGQLDFPTNLLIRFRGQVGIRDFSSCGFQPITPVVQCETI
SSAYLLDQFAHYRAYETVLWRNPNTGEEMQYRMVDLLRQYGSFARENSLNIYSSDKLKPM
LSILQSAKEYNEEEMITAAPLAERINRLDMLICTQGGDIMSMDKHWEKGDYGFVAVQLAD
CGRFAHTVALKSLKTRMERRKENPLGAFVISCALKGIELYGEKDAEAKIYDQIFPGLPLN
GFFSGGEIGPVAVPMGLPACITANAPRLQSNTTCGAVFYLKPSTSA
Download sequence
Identical sequences K3WC92
PYU1_T002583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]