SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T002614 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T002614
Domain Number 1 Region: 64-228,284-393
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.44e-52
Family p120GAP domain-like 0.0002
Further Details:      
 
Domain Number 2 Region: 540-759
Classification Level Classification E-value
Superfamily Bet v1-like 3.45e-26
Family STAR domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T002614
Sequence length 773
Comment protein Name="PYU1_T002614" Note="Similar to RASA1: Ras GTPase-activating protein 1 (Homo sapiens)" AED:0.0380919896640827 QI:0|0|0|1|1|1|3|0|773
Sequence
MMRVIRAARARFGHERERASTLPHSSTTVSTRHSRHSRRSTGAAETLDTTIKNAIESLTQ
DDAESALVFALVHDSEFRLATAIASNPAGADVNVIRALLFVFDTYEDQLRKFIGLLMFQE
MVDTLNWNELFRANSATTAIIREYTCDLGMEFLQQALQDIIVEMWETTDSYEINPKHLQE
GEDIEVNRERLEALADRILDRICNSAHLYPYQIAKIYRVLELEMMRLLERDRKSNISIPR
LSAIGEEQQQQGEDRRSNTSLPRISSIGEDGSDDLSLSSNSAAREEFQMHLGGLVFLRFI
CPALVLPHKMHLTPNDEAPSKNLQRNLVLVAKLFQSLANNVEYGAREDYMLPFNPFLARN
RSKLNRFYEQICQQSQNDNRRESMIARSHITPRISQVWTTINGKDSVVNLTGGVTVESSE
ENLPILRRWICENIEFITKEVAGDGKLRRRKKGIIVNSGLKKKKPKRKLKSVKSRSPFQH
PDIDVVKEVDEESERIASRSRGASAPVSPEELDEMIGHTSHRDIQLMKLYYSKLSQKGLQ
LLFEANDSQSNHEWVTYKSKDHVDVLRRDSSRFVCPSTGFRSDKDRFVEMKASVVVKSTP
RKLFQYLRSLDSMSEWDEYAGSIKKVEPLDDSRVIMYRSHPKLSLWPSWLVKPRDTCDLH
SFVEKTGRYDTFAVLMESIPRPDVPEIKGTVRMSYATGGFLIEPSFGEDVEVSQGADPAQ
GAFAKLTCVVRADFKGILPRYLAESICYRQVLSILSIRSRVEASRAQTDSNWV
Download sequence
Identical sequences K3WCC3
PYU1_T002614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]