SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T002616 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T002616
Domain Number - Region: 9-51
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00158
Family Ubiquitin-related 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T002616
Sequence length 58
Comment protein Name="PYU1_T002616" Note="Protein of unknown function" AED:0.106666666666667 QI:0|-1|0|1|-1|1|1|0|58
Sequence
METLSCMLVGTERDEFCIDIGMSETVAHLKDAVKKNKELDFPASNLHLYMAKRNNKWL
Download sequence
Identical sequences K3WCC5
PYU1_T002616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]