SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T002647 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T002647
Domain Number 1 Region: 18-129,171-432
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.57e-56
Family Regulator of chromosome condensation RCC1 0.0011
Further Details:      
 
Domain Number 2 Region: 437-512
Classification Level Classification E-value
Superfamily E set domains 0.0000327
Family E-set domains of sugar-utilizing enzymes 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T002647
Sequence length 576
Comment protein Name="PYU1_T002647" Note="Similar to HERC2: Probable E3 ubiquitin-protein ligase HERC2 (Drosophila melanogaster)" AED:0.175043327556326 QI:0|0|0|0.5|0|0|2|0|576
Sequence
MAAAPGAPSGSVSRSHGGLEGSHGILYVCGEKTCGKLTINESLLGRKLRGIHGGYDQFVA
IVDAWELEWEQSCHSDVALEHETVNDNLQHVKIHQVATGKQHRLALSLDGQIFSWGARDS
ALQNRELGQVGGCNGPRLPKSSSKQSQRVCTSPETGDDEVDEQERQAMCHGHTICQPRSV
HTSKELFFRRIACGRSHGAAITDKGDLYTWGRNFEGQLGHFSRTLSKETNSLLNGICAWP
KYVSEFLSKPRVTDVCCGEMFTVVLLENGAVYTFGERFTGITRHPEAKWDANPHLVIECG
SDGAGFVGIACGFAHALVVSSSGQLYSWGSNTFGQLGLGVSNSMEGATAVPTRVEMPGHE
WSKVFAGGNYSAAITNSGELFTWGNGKHGQLAHEAFSSSATFQCEYTPKCVEELQSTVIS
SVVCCQRNLYAFAPTHIMSISPVYGEITGGYELRIKGSGLWASEDLTVRFMPLTEGRLPR
GSLGIYHDETQEIVCQVPKFSLPGEFAIEIAMNGRHFTSNGNIFCAFKRPQVTAVSIYEA
KLDGGEPASITIEGNLPKTCLNPIVRFLPYASDNRG
Download sequence
Identical sequences K3WCF6
PYU1_T002647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]