SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T002685 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T002685
Domain Number 1 Region: 624-827
Classification Level Classification E-value
Superfamily Cyclin-like 1.29e-40
Family Retinoblastoma tumor suppressor domains 0.00012
Further Details:      
 
Domain Number 2 Region: 863-1006
Classification Level Classification E-value
Superfamily Cyclin-like 1.87e-24
Family Retinoblastoma tumor suppressor domains 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T002685
Sequence length 1175
Comment protein Name="PYU1_T002685" Note="Similar to RBR2: Retinoblastoma-related protein 2 (Oryza sativa subsp. japonica)" AED:0.0727471368294152 QI:0|-1|0|1|-1|1|1|0|1175
Sequence
MAPHMPAEGALERALRRALEGSSSSSAVLTALLADAALLRDAQTLFEQIAPRATPPPTTF
AATGRLGAHHRDGADANEKKVWALVAVVATGISHEMQQEKRAEAAEAAHGDPASRGKRKR
PPTGMDTIYERKNGQRDEPDDEEKQEDAEMRDDTDSKAAALRVDAEPTWNLIALLTDANI
SLSVFLRHFTSLFDRLLLDPELLEIATQLKEEFTIASVLFEKYRALWNKLVPPVGGAAHK
HEPPTHSPARHAVHVRHDRQDRGEVDREKEPEEPHQVPTSRRKNSMLLDQLVSVDRQQLL
HDAGWHLFLITKRRLSVQYTGLGPLYYLLLAVLHLVLSNVEAPSVEDEVAAALSALGSPA
PASAVANGHGSSSSSSNGKILEALCANPKVDQHEVKRAALDLGHVLEQMRADPAFLLTAT
TSSSTSEGAPTANSARAYASAVLNTDVISENISRLAEYYRKEYLDGCGKLDERFYLDPSV
HQVIMGPKPLPPSHPPSGTTSALSSPVPTKRPGRADRLIPTNPFSSPARQPMTPQRRESG
SAAVRGLSTPSRQHVAGTPGPPPSPFTSQAWQLHGLSSPPSTSSLSNARSIHTPNTRAFL
HTATNHQASPFVMQTPVTAAVETSNWVRDTLSSASGFVTPQLKMFFKDCTNDPTDHIAQI
LQDLSQKLMTSRRRAAGLPPTPNLDENDNMTQLPSFEYSEVDGSLKKTKNLAIALFYRVL
EALLVSEKDRLRTTNFSSLLNNETFVSSLYACSLEVVLKAHSLITLSFPFLLDILGVNAF
DFGKIIESFVKHVPKLPNVLKRHMRDLEQTILDSLGWRSDSGLYLVLAGDSKPTASDSSS
LAALTNGSTNANASASSARTSVLQLFFRKVLSLAASRIFRLGTMLELDAKYLNQVWTAIK
ECLSSQHALLKDRHLDQVILCSLYGVCKVNHVRPEVTFKRVIDCYKKLQHPQSTAINHGN
STPTSLVRNSNEIIRNIKLDDDSRGDIIKFYNRCYIPTMKVFMLQFQMQDKQMAAADAAV
VSATGANGAVSQAPPGFTPRREGSVVAASTSDTEIVAEAAADAVEKVMKSYGHGPGTPNR
PIRRSSAASPRIFGSPMSSLQLFTTAEVQSLPVSVHHTSPKRVLASNIYMSPLQQARLHH
RSHLTPRSHALYAFGESPSRVSKLVEQFVSCLKMI
Download sequence
Identical sequences K3WCJ4
PYU1_T002685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]