SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T002689 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T002689
Domain Number 1 Region: 665-772
Classification Level Classification E-value
Superfamily Homeodomain-like 4.12e-16
Family Paired domain 0.027
Further Details:      
 
Domain Number 2 Region: 433-538
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000797
Family Paired domain 0.048
Further Details:      
 
Domain Number 3 Region: 260-363
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000043
Family Paired domain 0.044
Further Details:      
 
Weak hits

Sequence:  PYU1_T002689
Domain Number - Region: 65-121
Classification Level Classification E-value
Superfamily Homeodomain-like 0.086
Family Myb/SANT domain 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T002689
Sequence length 816
Comment protein Name="PYU1_T002689" Note="Similar to msl-1: Protein male-specific lethal-1 (Drosophila melanogaster)" AED:0.053921568627451 QI:0|0|0|0.5|1|1|2|0|816
Sequence
MDDDDAVADALPQSPAPPTLRRAAQMTPASPSSPASSSPLEARKSLGVEDGDDGAEAAPD
AQVPSQQRKRGRPRLVDESKDRLILDVIQQRGTTNARMIQDELARKHSIKLTYEVIRRRV
KQLSLSATSDTRADSDTDDEDNVNESAGIQDPSIKKKKVEDDSDDSAKKSPAGPGHQRIA
RDLDMLAETVRTIVSNVHEQATPESSHGSEDSEKSSRDSFNNSDSEIASLLAPLSAEETA
EATDEHLPPASLTRGQFGEYSLEVCQLCVAKYAEGKTHKQVAEELQMPVTSVQTIIKKAK
RKGAVLPAQRAGRPRATSETMEQVILNVVTSDPTLSARAIQEQLRADYQLEVSFETIRRR
VRDCRKKVRESQAGETANDVEQSPNERGDASEDSSSEEQKRSTPASSILHPSMVLPLAKP
STQPATKRRKYGEYSTELREACVQKHEVEGLTYAAISSELNIPHDTVRAIVRKAKKTGTV
HTAPRSGRPRKTSDIVDKVIMQAVKANQRCTAKMIQEDLWNVFNVKVSCETVRRRVKANT
KHRLLTSASSGHASLTQHPSSSVSSLLSPISTTKPTPPLTGNSSGVPASHPLSVYQVPSL
NHVGLPGSLGNSLGAIQSILNDHDPNASRQSSSAIATASSQFSPPSGLLIPQPTPTIEQP
PRKKRNEYSVELREQCVTMHAQGHGYRRIGLELKMPHTTVRAIVEKVQRTGTVLPAARSG
RPRKTDEIVDKVILQAVKNNEKCSARMIQEELLQAYNVKVSCETIRRRVKDHSRQRHNSS
TSAVVDGSTEPTSGDSSRPGSQHQNVHIPASPATTT
Download sequence
Identical sequences K3WCJ8
PYU1_T002689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]