SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T002742 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T002742
Domain Number 1 Region: 518-697,728-973
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.06e-123
Family RNB domain-like 0.00000001
Further Details:      
 
Domain Number 2 Region: 429-532
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.57e-28
Family Cold shock DNA-binding domain-like 0.00024
Further Details:      
 
Domain Number 3 Region: 288-437
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.06e-27
Family Cold shock DNA-binding domain-like 0.00054
Further Details:      
 
Domain Number 4 Region: 976-1058
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000000308
Family Cold shock DNA-binding domain-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T002742
Sequence length 1096
Comment protein Name="PYU1_T002742" Note="Similar to DIS3: Exosome complex exonuclease RRP44 (Homo sapiens)" AED:0.255414101865676 QI:0|-1|0|1|-1|1|1|0|1096
Sequence
MPRAHDDDNDAGAAAESALLWCVDERNFATKRGKIIRTVKERYLRDDLSCSIPNCSLCVT
EDDTTASSHVMGMTKSILSTRPYNDVYLVPSMEVVLHQMDVLEFSTRKKHMDVEVFADII
ILETVWEFVKRHDLGVYNRLRALIMNPDRRFVVFANEHHRVSYVQKKRKLPVEPTTGSTG
TDSETSGEDSQLESDEERNCRAVAVAWKWYANHLLELQRRDVNVLFVANNAEDLANAERH
GVKNGTTIEEFLRPIEKECPELRDLMSTTATEGAAASSEGVSSSKKRKTLYPEHLKMSEV
LAGIKNKRFFQGVIRCNRDHALECHVLIHGVGDVKVPVLIQGREHINRAIDGDVVAIQLL
PKSQWKKPSDSFAASGSAAAEALEEDDDLEREKEEDERPEDIGVAEPTVPLEQAVLIQSD
LTLSIKPAGKVVGIIQRNWRKFCGSLEPPRTAGAVQSSSGHCLFVPIDRKVPKIKIQTRQ
QDTLMDKRILVAIDSWPADSKFPIGHYVRTLGVIGDKETETNVLLIEHDIPTDQFSDEVM
RCLPPEDWKITEENSTGRRDLRGLPVMSIDPPNCKDIDDALHVSLLPNGNLQVGVHIADV
THFVAPGSPLDEEAADRGTSTYLVDRRLDMLPGLLTTKLCSLTSTEDHFAFSVLWEMQLV
GGREVQIIDVSFCKSIIRSVASLSYQEAQVFLDDPEAGAVLGQGDKKQASANGKKANKDD
KEHARKNLLGGGIKTLNAIATRLREKRIQAGALTLASPEVRFVLDTETQNPLDVQMYALR
DTNALVEEFMLLANITVAKKIVRHFPTFSMLRRHPAPSKRQFDLLCSQAKAVGVDLQVDS
SKQLQDSLDTAQEQETKTSKKNPYFNKLLRILCTRCMMPASYFSSGEVTPKEFHHYGLAA
PIYTHFTSPIRRYADVVVHRLLAAAIGVTPLPNYLENKSHLHEISEQLNRRHHAAQLAGR
ASTSLHTLLYFKQFPTTTDAVITKVKNNGVGVLLPRFGIEGMIFLCEKDEQDDDKVVSFD
ADKHILTLWKQNGRQLQVFDKIQVKVYVALTFGNRQELKMDLVTEEEMSAEDNDVVSSKK
RPQQRQQKPAPKKRKA
Download sequence
Identical sequences K3WCQ1
PYU1_T002742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]