SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T002824 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T002824
Domain Number 1 Region: 46-292,393-456
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.74e-50
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.00011
Further Details:      
 
Domain Number 2 Region: 275-389
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 9.12e-41
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.0000163
Further Details:      
 
Domain Number 3 Region: 476-553
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.00000000484
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T002824
Sequence length 558
Comment protein Name="PYU1_T002824" Note="Similar to nadB: L-aspartate oxidase (Pseudomonas aeruginosa)" AED:0.00178890876565296 QI:0|-1|0|1|-1|1|1|0|558
Sequence
MTQLDVVSRIGSAKFNDEVLMNNTVIPRRKISLSALRRMSAASLAAETYDTIECKALIIG
CGVAGNATALRLANRGIKVTVISAAEDPHNCATYWAQGGIIYKSEDDSPQLLASDVHRAG
AGVCDDAAVQKLAMEGPGRVEELLLDVSNVPFARDDKGELLLTLEASHNRARILYKADHT
GKAIATSMVQAIRVHPNIVLVSGRSAFELVKNERGECVGALTVSTSGKIEHYRAPFTMLA
TGGVGDVYKNTSNPEGARGEGIALAARAGAKLKNMQYVQFHPTTLCIPNERRFLLTEALR
GEGAILRDRNGRAFAKDYHPDGELAPRDVVARTILAEMEKQGESCMYLDISHEDAKWIKE
RFPTIYQHCLARGIDMTKEPMPVVPAAHYHCGGVEVDLNGCTSVPGLYAAGEVSCTGVHG
ANRLASTSLLEGLVWGCSSADHFLENFRTLEPSPENTDPFAGINGFRDASVNEMDEVLFA
TQRIMWESVGPKRTKAGMASAVEKLTLLETKADKLYRESYVTRQSAGLRNAVRAAKEIAL
AALNSPVSVGTHYIIQDP
Download sequence
Identical sequences K3WCY3
PYU1_T002824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]