SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T002829 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T002829
Domain Number 1 Region: 34-87
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000596
Family Myb/SANT domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T002829
Sequence length 201
Comment protein Name="PYU1_T002829" Note="Similar to mybH: Myb-like protein H (Dictyostelium discoideum)" AED:0.00990099009900991 QI:0|-1|0|1|-1|1|1|0|201
Sequence
MVISDHIKSQYFLNDEQVIRLSPPVMAQPDTETRRMGTPWTAEEHNLFLEALEKHPSGPW
KLIAAHIGTRTTRQTMTHAQRYREKIARRKRTLTQAGLAALHAAESSTPPASTKPPQPAT
PAASNDSAAAEATAAADSDFDLIDSDTELSFADFNISLNDDVEGMDSERLLLSVIDSYEP
LPFSEEEARTMLEHFTSDSSV
Download sequence
Identical sequences K3WCY8
PYU1_T002829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]