SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T002834 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T002834
Domain Number 1 Region: 33-87
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000247
Family Myb/SANT domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T002834
Sequence length 183
Comment protein Name="PYU1_T002834" Note="Similar to mybJ: Myb-like protein J (Dictyostelium discoideum)" AED:0.352327447833066 QI:0|-1|0|1|-1|1|1|0|183
Sequence
MVITSRVKSQYFENEQSVIRIAPKHSKPNAKSKRVGTPWTPEEHDRFLHALEHHPSGPWK
LIAEFVATRTTRQTMTHAQKYRERISRQKKASEGKDDDRLRNSLCATRSPSTQEEQLKET
GTANALERSDAFLLSFSEIDDIYDAMLATFLDASYETDFQFSNDVGSTEANEDLDALMLP
VMS
Download sequence
Identical sequences K3WCZ3
PYU1_T002834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]