SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T002836 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T002836
Domain Number 1 Region: 33-86
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000001
Family Myb/SANT domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T002836
Sequence length 184
Comment protein Name="PYU1_T002836" Note="Similar to mybI: Myb-like protein I (Dictyostelium discoideum)" AED:0.351524879614767 QI:0|-1|0|1|-1|1|1|0|184
Sequence
MTITSHVQSQYFVNDAQIIRLPPSSQQSEKKTKRSGQPWTTEEHNRFLEAMQRFPSGPWK
IIASHVGTRTTRQTMTHAQRYREKIARRKRTLAEAHLSGCPVPQPINYDMPTTEVEDLDL
YGSDNDDLLQAISDTDLMLNFNFEAADSDMDEQLLLSLVESYEPVPFSAEDAQWMVEHLA
PASQ
Download sequence
Identical sequences K3WCZ5
PYU1_T002836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]